C17orf57 Antikörper (N-Term)

Produktnummer ABIN632216

Der Kaninchen Polyklonal anti-C17orf57 Antikörper wird verwendet zum Nachweis von C17orf57 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für C17orf57 Antikörper (N-Term) (ABIN632216)

Target: C17orf57 (Chromosome 17 Open Reading Frame 57 (C17orf57))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C17orf57 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C17orf57 Antikörper

Bindungsspezifität: N-Term

Spezifität: C17 ORF57 antibody was raised against the N terminal Of C17 rf57

Aufreinigung: Affinity purified

Immunogen: C17 ORF57 antibody was raised using the N terminal Of C17 rf57 corresponding to a region with amino acids CGEEKSSDFSGEKKVGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENSL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C17ORF57 Blocking Peptide, (ABIN937080), is also available for use as a blocking control in assays to test for specificity of this C17ORF57 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF57 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C17orf57

Target: C17orf57 (Chromosome 17 Open Reading Frame 57 (C17orf57))

Andere Bezeichnung: C17ORF57

Hintergrund: The function of C17orf57 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 110 kDa (MW of target protein)