ANKRD13B Antikörper (Middle Region)

Produktnummer ABIN632215

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ANKRD13B in WB. Es zeigt Reaktivität gegenüber Proben von Human und Ratte.

Kurzübersicht für ANKRD13B Antikörper (Middle Region) (ABIN632215)

Target: ANKRD13B (Ankyrin Repeat Domain 13B (ANKRD13B))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANKRD13B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ANKRD13B Antikörper

Bindungsspezifität: Middle Region

Spezifität: ANKRD13 B antibody was raised against the middle region of ANKRD13

Aufreinigung: Affinity purified

Immunogen: ANKRD13 B antibody was raised using the middle region of ANKRD13 corresponding to a region with amino acids HPMSYEGRRQDRSAPPTPQRQPAPPASVPSPRPSSGPGSGGHVFRSYDEQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANKRD13B Blocking Peptide, (ABIN939200), is also available for use as a blocking control in assays to test for specificity of this ANKRD13B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANKRD13B

Target: ANKRD13B (Ankyrin Repeat Domain 13B (ANKRD13B))

Andere Bezeichnung: ANKRD13B

Hintergrund: The function of ANKRD13B protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 70 kDa (MW of target protein)