CAMKV Antikörper (N-Term)

Produktnummer ABIN632211

Dieses Anti-CAMKV-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CAMKV in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für CAMKV Antikörper (N-Term) (ABIN632211)

Target: CAMKV (CaM Kinase-Like Vesicle-Associated (CAMKV))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CAMKV Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CAMKV Antikörper

Bindungsspezifität: N-Term

Spezifität: CAMKV antibody was raised against the N terminal of CAMKV

Aufreinigung: Affinity purified

Immunogen: CAMKV antibody was raised using the N terminal of CAMKV corresponding to a region with amino acids NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CAMKV Blocking Peptide, (ABIN5612596), is also available for use as a blocking control in assays to test for specificity of this CAMKV antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMKV antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CAMKV

Target: CAMKV (CaM Kinase-Like Vesicle-Associated (CAMKV))

Andere Bezeichnung: CAMKV

Hintergrund: CAMKV does not appear to have detectable kinase activity.

Molekulargewicht: 55 kDa (MW of target protein)