HAGH Antikörper (C-Term)

Produktnummer ABIN632208

Dieses Anti-HAGH-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von HAGH in WB. Geeignet für Human.

Kurzübersicht für HAGH Antikörper (C-Term) (ABIN632208)

Target: HAGH (Hydroxyacylglutathione Hydrolase (HAGH))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HAGH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HAGH Antikörper

Bindungsspezifität: C-Term

Spezifität: HAGH antibody was raised against the C terminal of HAGH

Aufreinigung: Affinity purified

Immunogen: HAGH antibody was raised using the C terminal of HAGH corresponding to a region with amino acids FARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HAGH Blocking Peptide, (ABIN938233), is also available for use as a blocking control in assays to test for specificity of this HAGH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAGH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HAGH

Target: HAGH (Hydroxyacylglutathione Hydrolase (HAGH))

Andere Bezeichnung: HAGH

Hintergrund: HAGH is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate. The enzyme encoded by this gene is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.

Molekulargewicht: 29 kDa (MW of target protein)