C11orf65 Antikörper (N-Term)

Produktnummer ABIN632207

Der Kaninchen Polyklonal Anti-C11orf65-Antikörper wurde für WB validiert. Er ist geeignet, C11orf65 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für C11orf65 Antikörper (N-Term) (ABIN632207)

Target: C11orf65 (Chromosome 11 Open Reading Frame 65 (C11orf65))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C11orf65 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C11orf65 Antikörper

Bindungsspezifität: N-Term

Spezifität: C11 ORF65 antibody was raised against the N terminal Of C11 rf65

Aufreinigung: Affinity purified

Immunogen: C11 ORF65 antibody was raised using the N terminal Of C11 rf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C11ORF65 Blocking Peptide, (ABIN5612393), is also available for use as a blocking control in assays to test for specificity of this C11ORF65 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF65 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C11orf65

Target: C11orf65 (Chromosome 11 Open Reading Frame 65 (C11orf65))

Andere Bezeichnung: C11ORF65

Hintergrund: The specific function of C11orf65 is not yet known.

Molekulargewicht: 37 kDa (MW of target protein)