ASB11 Antikörper (C-Term)

Produktnummer ABIN632206

Produktdetails anti-ASB11 Antikörper

Target: ASB11 (Ankyrin Repeat and SOCS Box-Containing 11 (ASB11))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASB11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ASB11 antibody was raised against the C terminal of ASB11

Aufreinigung: Affinity purified

Immunogen: ASB11 antibody was raised using the C terminal of ASB11 corresponding to a region with amino acids GQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASB11 Blocking Peptide, catalog no. 33R-3519, is also available for use as a blocking control in assays to test for specificity of this ASB11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASB11

Target: ASB11 (Ankyrin Repeat and SOCS Box-Containing 11 (ASB11))

Andere Bezeichnung: ASB11 (ASB11 Produkte)

Synonyme: ASB11 antikoerper, asb-a antikoerper, zgc:136370 antikoerper, zgc:158532 antikoerper, DKFZp468G0324 antikoerper, 1110067L12Rik antikoerper, 1600009D24Rik antikoerper, RGD1566298 antikoerper, ankyrin repeat and SOCS box-containing 11 antikoerper, ankyrin repeat and SOCS box containing 11 antikoerper, ASB11 antikoerper, asb11 antikoerper, Asb11 antikoerper

Hintergrund: ASB11 is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation.

Molekulargewicht: 33 kDa (MW of target protein)