Choline Kinase alpha Antikörper (Middle Region)

Produktnummer ABIN632201

Produktdetails anti-Choline Kinase alpha Antikörper

Target: Choline Kinase alpha (CHKA)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Choline Kinase alpha Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CHKA antibody was raised against the middle region of CHKA

Aufreinigung: Affinity purified

Immunogen: CHKA antibody was raised using the middle region of CHKA corresponding to a region with amino acids LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHKA Blocking Peptide, catalog no. 33R-4929, is also available for use as a blocking control in assays to test for specificity of this CHKA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHKA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Choline Kinase alpha

Target: Choline Kinase alpha (CHKA)

Andere Bezeichnung: CHKA (CHKA Produkte)

Synonyme: im:7143625 antikoerper, wu:fd46h01 antikoerper, si:dkey-12e7.3 antikoerper, CHKA antikoerper, chkb antikoerper, ATCK1 antikoerper, CHOLINE KINASE antikoerper, CK antikoerper, F14O23.8 antikoerper, F14O23_8 antikoerper, choline kinase 1 antikoerper, CHK antikoerper, CKI antikoerper, EK antikoerper, CK/EK-alpha antikoerper, Chetk-alpha antikoerper, Chk antikoerper, ChoK antikoerper, EtnK-alpha antikoerper, CK-R antikoerper, choline kinase alpha antikoerper, choline kinase antikoerper, choline kinase 1 antikoerper, chka antikoerper, CHKA antikoerper, MCYG_00090 antikoerper, PF14_0020 antikoerper, CK1 antikoerper, CNI01400 antikoerper, Chka antikoerper

Hintergrund: The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. CHKA is the initial enzyme in the sequence and may play a regulatory role. It also catalyzes the phosphorylation of ethanolamine.

Molekulargewicht: 50 kDa (MW of target protein)