Choline Kinase alpha Antikörper (Middle Region)
-
- Target Alle Choline Kinase alpha (CHKA) Antikörper anzeigen
- Choline Kinase alpha (CHKA)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Choline Kinase alpha Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CHKA antibody was raised against the middle region of CHKA
- Aufreinigung
- Affinity purified
- Immunogen
- CHKA antibody was raised using the middle region of CHKA corresponding to a region with amino acids LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI
- Top Product
- Discover our top product CHKA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHKA Blocking Peptide, catalog no. 33R-4929, is also available for use as a blocking control in assays to test for specificity of this CHKA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHKA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Choline Kinase alpha (CHKA)
- Andere Bezeichnung
- CHKA (CHKA Produkte)
- Synonyme
- im:7143625 antikoerper, wu:fd46h01 antikoerper, si:dkey-12e7.3 antikoerper, CHKA antikoerper, chkb antikoerper, ATCK1 antikoerper, CHOLINE KINASE antikoerper, CK antikoerper, F14O23.8 antikoerper, F14O23_8 antikoerper, choline kinase 1 antikoerper, CHK antikoerper, CKI antikoerper, EK antikoerper, CK/EK-alpha antikoerper, Chetk-alpha antikoerper, Chk antikoerper, ChoK antikoerper, EtnK-alpha antikoerper, CK-R antikoerper, choline kinase alpha antikoerper, choline kinase antikoerper, choline kinase 1 antikoerper, chka antikoerper, CHKA antikoerper, MCYG_00090 antikoerper, PF14_0020 antikoerper, CK1 antikoerper, CNI01400 antikoerper, Chka antikoerper
- Hintergrund
- The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. CHKA is the initial enzyme in the sequence and may play a regulatory role. It also catalyzes the phosphorylation of ethanolamine.
- Molekulargewicht
- 50 kDa (MW of target protein)
-