Choline Kinase alpha Antikörper (Middle Region)

Produktnummer ABIN632201

Der Kaninchen Polyklonal Anti-Choline Kinase alpha-Antikörper wurde für WB validiert. Er ist geeignet, Choline Kinase alpha in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für Choline Kinase alpha Antikörper (Middle Region) (ABIN632201)

Target: Choline Kinase alpha (CHKA)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Choline Kinase alpha Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Choline Kinase alpha Antikörper

Bindungsspezifität: Middle Region

Spezifität: CHKA antibody was raised against the middle region of CHKA

Aufreinigung: Affinity purified

Immunogen: CHKA antibody was raised using the middle region of CHKA corresponding to a region with amino acids LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHKA Blocking Peptide, (ABIN940315), is also available for use as a blocking control in assays to test for specificity of this CHKA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHKA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Choline Kinase alpha

Target: Choline Kinase alpha (CHKA)

Andere Bezeichnung: CHKA

Hintergrund: The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. CHKA is the initial enzyme in the sequence and may play a regulatory role. It also catalyzes the phosphorylation of ethanolamine.

Molekulargewicht: 50 kDa (MW of target protein)