serine Dehydratase Antikörper (N-Term)

Produktnummer ABIN632200

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch serine Dehydratase in WB. Er zeigt eine Reaktivität gegenüber Human, Ratte und Maus.

Kurzübersicht für serine Dehydratase Antikörper (N-Term) (ABIN632200)

Target: serine Dehydratase (SDS)

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser serine Dehydratase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-serine Dehydratase Antikörper

Bindungsspezifität: N-Term

Spezifität: SDS antibody was raised against the N terminal of SDS

Aufreinigung: Affinity purified

Immunogen: SDS antibody was raised using the N terminal of SDS corresponding to a region with amino acids AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SDS Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SDS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu serine Dehydratase

Target: serine Dehydratase (SDS)

Andere Bezeichnung: SDS

Hintergrund: This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor.

Molekulargewicht: 34 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly