DPP3 Antikörper (N-Term)

Produktnummer ABIN632199

Dieses Anti-DPP3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von DPP3 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für DPP3 Antikörper (N-Term) (ABIN632199)

Target: DPP3 (Dipeptidyl-Peptidase 3 (DPP3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DPP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DPP3 Antikörper

Bindungsspezifität: N-Term

Spezifität: DPP3 antibody was raised against the N terminal of DPP3

Aufreinigung: Affinity purified

Immunogen: DPP3 antibody was raised using the N terminal of DPP3 corresponding to a region with amino acids SRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DPP3 Blocking Peptide, (ABIN5613249), is also available for use as a blocking control in assays to test for specificity of this DPP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPP3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DPP3

Target: DPP3 (Dipeptidyl-Peptidase 3 (DPP3))

Andere Bezeichnung: DPP3

Hintergrund: DPP3 is a protein that is a member of the S9B family in clan SC of the serine proteases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers.

Molekulargewicht: 82 kDa (MW of target protein)