WBP2 Antikörper (N-Term)

Produktnummer ABIN632196

Dieses Anti-WBP2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von WBP2 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für WBP2 Antikörper (N-Term) (ABIN632196)

Target: WBP2 (WW Domain Binding Protein 2 (WBP2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WBP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-WBP2 Antikörper

Bindungsspezifität: N-Term

Spezifität: WBP2 antibody was raised against the N terminal of WBP2

Aufreinigung: Affinity purified

Immunogen: WBP2 antibody was raised using the N terminal of WBP2 corresponding to a region with amino acids MKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WBP2 Blocking Peptide, (ABIN5616990), is also available for use as a blocking control in assays to test for specificity of this WBP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WBP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WBP2

Target: WBP2 (WW Domain Binding Protein 2 (WBP2))

Andere Bezeichnung: WBP2

Hintergrund: The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding

Molekulargewicht: 28 kDa (MW of target protein)