FAM217A Antikörper (Middle Region)

Produktnummer ABIN632181

Der Kaninchen Polyklonal anti-FAM217A Antikörper (ABIN632181) detektiert spezifisch FAM217A in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für FAM217A Antikörper (Middle Region) (ABIN632181)

Target: FAM217A (Family with Sequence Similarity 217, Member A (FAM217A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM217A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM217A Antikörper

Bindungsspezifität: Middle Region

Spezifität: C6 ORF146 antibody was raised against the middle region of C6 rf146

Aufreinigung: Affinity purified

Immunogen: C6 ORF146 antibody was raised using the middle region of C6 rf146 corresponding to a region with amino acids ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C6ORF146 Blocking Peptide, (ABIN938151), is also available for use as a blocking control in assays to test for specificity of this C6ORF146 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF146 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM217A

Target: FAM217A (Family with Sequence Similarity 217, Member A (FAM217A))

Andere Bezeichnung: C6ORF146

Hintergrund: The specific function of C6orf146 is not yet known.

Molekulargewicht: 57 kDa (MW of target protein)