METTL5 Antikörper (N-Term)

Produktnummer ABIN632173

Produktdetails anti-METTL5 Antikörper

Target: METTL5 (Methyltransferase Like 5 (METTL5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser METTL5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: METTL5 antibody was raised against the N terminal of METTL5

Aufreinigung: Affinity purified

Immunogen: METTL5 antibody was raised using the N terminal of METTL5 corresponding to a region with amino acids IAACMLYTIHNTYDDIENKVVADLGCGCGVLSIGTAMLGAGLCVGFDIDE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

METTL5 Blocking Peptide, catalog no. 33R-3885, is also available for use as a blocking control in assays to test for specificity of this METTL5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu METTL5

Target: METTL5 (Methyltransferase Like 5 (METTL5))

Andere Bezeichnung: METTL5 (METTL5 Produkte)

Synonyme: im:7137598 antikoerper, zgc:103655 antikoerper, HSPC133 antikoerper, 2810410A08Rik antikoerper, RGD1566062 antikoerper, methyltransferase like 5 antikoerper, mettl5 antikoerper, METTL5 antikoerper, Mettl5 antikoerper

Hintergrund: METTL5 is a probable methyltransferase.

Molekulargewicht: 24 kDa (MW of target protein)