LIX1 Antikörper

Produktnummer ABIN632169

Dieses Anti-LIX1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von LIX1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für LIX1 Antikörper (ABIN632169)

Target: LIX1 (Lix1 Homolog (LIX1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LIX1 Antikörper

Aufreinigung: Affinity purified

Immunogen: LIX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMES

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LIX1 Blocking Peptide, (ABIN5614472), is also available for use as a blocking control in assays to test for specificity of this LIX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LIX1

Target: LIX1 (Lix1 Homolog (LIX1))

Andere Bezeichnung: LIX1

Hintergrund: The function of LIX1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 32 kDa (MW of target protein)