Tektin 4 Antikörper (N-Term)

Produktnummer ABIN632168

Produktdetails anti-Tektin 4 Antikörper

Target: Tektin 4 (TEKT4)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Tektin 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Tektin 4 antibody was raised against the N terminal of TEKT4

Aufreinigung: Affinity purified

Immunogen: Tektin 4 antibody was raised using the N terminal of TEKT4 corresponding to a region with amino acids LATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tektin 4 Blocking Peptide, catalog no. 33R-4802, is also available for use as a blocking control in assays to test for specificity of this Tektin 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEKT4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Tektin 4

Target: Tektin 4 (TEKT4)

Andere Bezeichnung: Tektin 4 (TEKT4 Produkte)

Synonyme: ECGP antikoerper, GP96 antikoerper, GRP94 antikoerper, TRA1 antikoerper, 1700010L19Rik antikoerper, RGD1308075 antikoerper, Tek4 antikoerper, Tektin4 antikoerper, Tekt4 antikoerper, heat shock protein 90 beta family member 1 antikoerper, tektin 4 antikoerper, tektin-4 antikoerper, tektin 4 S homeolog antikoerper, HSP90B1 antikoerper, Tekt4 antikoerper, TEKT4 antikoerper, LOC490081 antikoerper, tekt4.S antikoerper, tekt4 antikoerper, LOC100719827 antikoerper, LOC110259951 antikoerper

Hintergrund: TEKT4 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules.

Molekulargewicht: 51 kDa (MW of target protein)