EIF3E Antikörper (Middle Region)

Produktnummer ABIN632165

Produktdetails anti-EIF3E Antikörper

Target: EIF3E (Eukaryotic Translation Initiation Factor 3 Subunit E (EIF3E))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF3E Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF3 E antibody was raised against the middle region of EIF3

Aufreinigung: Affinity purified

Immunogen: EIF3 E antibody was raised using the middle region of EIF3 corresponding to a region with amino acids LNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF3E Blocking Peptide, catalog no. 33R-5232, is also available for use as a blocking control in assays to test for specificity of this EIF3E antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF3E

Target: EIF3E (Eukaryotic Translation Initiation Factor 3 Subunit E (EIF3E))

Andere Bezeichnung: EIF3E (EIF3E Produkte)

Synonyme: EIF3-P48 antikoerper, EIF3S6 antikoerper, INT6 antikoerper, eIF3-p46 antikoerper, 48kDa antikoerper, Eif3s6 antikoerper, Int6 antikoerper, eIF3-p48 antikoerper, eif3-p48 antikoerper, eif3s6 antikoerper, eif3s6-A antikoerper, eIF3e antikoerper, eIF3-S6 antikoerper, eif3s6-B antikoerper, EIF3SE antikoerper, eif3s6b antikoerper, im:7147439 antikoerper, QtsA-18056 antikoerper, eukaryotic translation initiation factor 3 subunit E antikoerper, eukaryotic translation initiation factor 3, subunit E antikoerper, eukaryotic translation initiation factor 3 subunit E L homeolog antikoerper, eukaryotic translation initiation factor 3 subunit 6 antikoerper, eukaryotic translation initiation factor 3 subunit E S homeolog antikoerper, eukaryotic translation initiation factor 3, subunit E, a antikoerper, Eukaryotic translation initiation factor 3 subunit E antikoerper, eukaryotic translation initiation factor 3, subunit E, b antikoerper, EIF3E antikoerper, Eif3e antikoerper, eif3e antikoerper, eif3e.L antikoerper, LOC692936 antikoerper, eif3e.S antikoerper, eif3ea antikoerper, eif-3.E antikoerper, eif3eb antikoerper, LOC108348260 antikoerper, int6 antikoerper

Hintergrund: EIF3E belongs to the eIF-3 subunit E family.It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. EIF3E is required for nonsense-mediated mRNA decay (NMD), It may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. The protein may interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Hepatitis C