EIF3E Antikörper (N-Term)
-
- Target Alle EIF3E Antikörper anzeigen
- EIF3E (Eukaryotic Translation Initiation Factor 3 Subunit E (EIF3E))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EIF3E Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EIF3 E antibody was raised against the N terminal of EIF3
- Aufreinigung
- Affinity purified
- Immunogen
- EIF3 E antibody was raised using the N terminal of EIF3 corresponding to a region with amino acids ELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQ
- Top Product
- Discover our top product EIF3E Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EIF3E Blocking Peptide, catalog no. 33R-2557, is also available for use as a blocking control in assays to test for specificity of this EIF3E antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF3E (Eukaryotic Translation Initiation Factor 3 Subunit E (EIF3E))
- Andere Bezeichnung
- EIF3E (EIF3E Produkte)
- Synonyme
- EIF3-P48 antikoerper, EIF3S6 antikoerper, INT6 antikoerper, eIF3-p46 antikoerper, 48kDa antikoerper, Eif3s6 antikoerper, Int6 antikoerper, eIF3-p48 antikoerper, eif3-p48 antikoerper, eif3s6 antikoerper, eif3s6-A antikoerper, eIF3e antikoerper, eIF3-S6 antikoerper, eif3s6-B antikoerper, EIF3SE antikoerper, eif3s6b antikoerper, im:7147439 antikoerper, QtsA-18056 antikoerper, eukaryotic translation initiation factor 3 subunit E antikoerper, eukaryotic translation initiation factor 3, subunit E antikoerper, eukaryotic translation initiation factor 3 subunit E L homeolog antikoerper, eukaryotic translation initiation factor 3 subunit 6 antikoerper, eukaryotic translation initiation factor 3 subunit E S homeolog antikoerper, eukaryotic translation initiation factor 3, subunit E, a antikoerper, Eukaryotic translation initiation factor 3 subunit E antikoerper, eukaryotic translation initiation factor 3, subunit E, b antikoerper, EIF3E antikoerper, Eif3e antikoerper, eif3e antikoerper, eif3e.L antikoerper, LOC692936 antikoerper, eif3e.S antikoerper, eif3ea antikoerper, eif-3.E antikoerper, eif3eb antikoerper, LOC108348260 antikoerper, int6 antikoerper
- Hintergrund
- EIF3E belongs to the eIF-3 subunit E family.It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. EIF3E is required for nonsense-mediated mRNA decay (NMD), It may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. The protein may interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.
- Molekulargewicht
- 52 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Hepatitis C
-