IFIT3 Antikörper (N-Term)

Produktnummer ABIN632163

Dieses Anti-IFIT3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von IFIT3 in WB und IHC. Geeignet für Human.

Kurzübersicht für IFIT3 Antikörper (N-Term) (ABIN632163)

Target: IFIT3 (Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IFIT3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-IFIT3 Antikörper

Bindungsspezifität: N-Term

Spezifität: IFIT3 antibody was raised against the N terminal of IFIT3

Aufreinigung: Affinity purified

Immunogen: IFIT3 antibody was raised using the N terminal of IFIT3 corresponding to a region with amino acids ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IFIT3 Blocking Peptide, (ABIN936954), is also available for use as a blocking control in assays to test for specificity of this IFIT3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFIT3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IFIT3

Target: IFIT3 (Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3))

Andere Bezeichnung: IFIT3

Hintergrund: IFIT3 is involved in protein binding.

Molekulargewicht: 56 kDa (MW of target protein)