TADA1 Antikörper

Produktnummer ABIN632160

Dieser Anti-TADA1 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von TADA1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für TADA1 Antikörper (ABIN632160)

Target: TADA1 (Transcriptional Adaptor 1 (TADA1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TADA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TADA1 Antikörper

Aufreinigung: Affinity purified

Immunogen: TADA1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TADA1L Blocking Peptide, (ABIN5616494), is also available for use as a blocking control in assays to test for specificity of this TADA1L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TADA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TADA1

Target: TADA1 (Transcriptional Adaptor 1 (TADA1))

Andere Bezeichnung: TADA1L

Hintergrund: TADA1L belongs to the TADA1L family.It is probably involved in transcriptional regulation.

Molekulargewicht: 37 kDa (MW of target protein)