ERP44 Antikörper

Produktnummer ABIN632154

Dieses Anti-ERP44-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ERP44 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für ERP44 Antikörper (ABIN632154)

Target: ERP44 (Endoplasmic Reticulum Protein 44 (ERP44))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERP44 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ERP44 Antikörper

Aufreinigung: Affinity purified

Immunogen: TXNDC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TXNDC4 Blocking Peptide, (ABIN940411), is also available for use as a blocking control in assays to test for specificity of this TXNDC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ERP44

Target: ERP44 (Endoplasmic Reticulum Protein 44 (ERP44))

Andere Bezeichnung: TXNDC4

Hintergrund: TXNDC4 mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. TXNDC4 inhibits the calcium channel activity of ITPR1. TXNDC4 may have a role in the control of oxidative protein folding in the endoplasmic reticulum. TXNDC4 is required to retain ERO1L and ERO1LB in the endoplasmic reticulum.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis, SARS-CoV-2 Protein Interaktom