Lipase I Antikörper (Middle Region)

Produktnummer ABIN632150

Produktdetails anti-Lipase I Antikörper

Target: Lipase I (LIPI)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Lipase I Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LIPI antibody was raised against the middle region of LIPI

Aufreinigung: Affinity purified

Immunogen: LIPI antibody was raised using the middle region of LIPI corresponding to a region with amino acids YFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LIPI Blocking Peptide, catalog no. 33R-10099, is also available for use as a blocking control in assays to test for specificity of this LIPI antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIPI antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Lipase I

Target: Lipase I (LIPI)

Andere Bezeichnung: LIPI (LIPI Produkte)

Synonyme: CT17 antikoerper, LPDL antikoerper, PLA1C antikoerper, lipi antikoerper, lpdl antikoerper, lpdlr antikoerper, pla1b antikoerper, pred5 antikoerper, mpa-pla1 antikoerper, D930038D03Rik antikoerper, lpd1 antikoerper, Liph antikoerper, lipase I antikoerper, lipase, member H antikoerper, lipase, member I antikoerper, LIPI antikoerper, liph antikoerper, Lipi antikoerper

Hintergrund: The protein encoded by this gene is a phospholipase that hydrolyzes phosphatidic acid to produce lysophosphatidic acid. The encoded protein, which can be inhibited by sodium vanadate, may be found exclusively in sperm. Defects in this gene are a cause of susceptibility to familial hypertrigliceridemia.

Molekulargewicht: 55 kDa (MW of target protein)