C19orf54 Antikörper (N-Term)

Produktnummer ABIN632149

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch C19orf54 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für C19orf54 Antikörper (N-Term) (ABIN632149)

Target: C19orf54 (Chromosome 19 Open Reading Frame 54 (C19orf54))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C19orf54 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C19orf54 Antikörper

Bindungsspezifität: N-Term

Spezifität: C19 ORF54 antibody was raised against the N terminal Of C19 rf54

Aufreinigung: Affinity purified

Immunogen: C19 ORF54 antibody was raised using the N terminal Of C19 rf54 corresponding to a region with amino acids MTSPCSPPLKPPISPPKTPVPQASSIPSPPLPPSPLDFSALPSPPWSQQT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C19ORF54 Blocking Peptide, (ABIN5612446), is also available for use as a blocking control in assays to test for specificity of this C19ORF54 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF54 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C19orf54

Target: C19orf54 (Chromosome 19 Open Reading Frame 54 (C19orf54))

Andere Bezeichnung: C19ORF54

Hintergrund: The function of Chromosome 19 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 23 kDa (MW of target protein)