RPESP Antikörper (Middle Region)
-
- Target Alle RPESP (C8orf84) Produkte
- RPESP (C8orf84) (Chromosome 8 Open Reading Frame 84 (C8orf84))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Maus, Ratte, Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPESP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RPESP antibody was raised against the middle region of RPESP
- Aufreinigung
- Affinity purified
- Immunogen
- RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RPESP Blocking Peptide, catalog no. 33R-5349, is also available for use as a blocking control in assays to test for specificity of this RPESP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPESP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPESP (C8orf84) (Chromosome 8 Open Reading Frame 84 (C8orf84))
- Andere Bezeichnung
- RPESP (C8orf84 Produkte)
- Hintergrund
- RPESP belongs to the thrombospondin family. It contains 1 SMB (somatomedin-B) domain and 1 TSP type-1 domain. The exact function of RPESP remains unknown.
- Molekulargewicht
- 29 kDa (MW of target protein)
-