RPESP Antikörper (Middle Region)

Produktnummer ABIN632147

Der Kaninchen-Polyklonal Anti-RPESP-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von RPESP in Proben aus Maus, Ratte und Human. }

Kurzübersicht für RPESP Antikörper (Middle Region) (ABIN632147)

Target: RPESP (C8orf84) (Chromosome 8 Open Reading Frame 84 (C8orf84))

Reaktivität: Maus, Ratte, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPESP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPESP Antikörper

Bindungsspezifität: Middle Region

Spezifität: RPESP antibody was raised against the middle region of RPESP

Aufreinigung: Affinity purified

Immunogen: RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPESP Blocking Peptide, (ABIN5615932), is also available for use as a blocking control in assays to test for specificity of this RPESP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPESP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPESP

Target: RPESP (C8orf84) (Chromosome 8 Open Reading Frame 84 (C8orf84))

Andere Bezeichnung: RPESP

Hintergrund: RPESP belongs to the thrombospondin family. It contains 1 SMB (somatomedin-B) domain and 1 TSP type-1 domain. The exact function of RPESP remains unknown.

Molekulargewicht: 29 kDa (MW of target protein)