-
- Target Alle TRIB3 Antikörper anzeigen
- TRIB3 (Tribbles Homolog 3 (Drosophila) (TRIB3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRIB3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TRIB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV
- Top Product
- Discover our top product TRIB3 Primärantikörper
-
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) (AA 56-145) antibody
TRIB3 Reaktivität: Human WB, ELISA, IF, RNAi Wirt: Maus Monoclonal 1H2 unconjugated
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) (AA 56-145) antibodyTRIB3 Reaktivität: Human WB, ELISA, IP Wirt: Maus Monoclonal 3D7 unconjugated
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) (AA 15-45), (N-Term) antibodyTRIB3 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB4069-RB4070 unconjugated
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) (N-Term) antibodyTRIB3 Reaktivität: Human WB, ELISA, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) (AA 152-325) antibodyTRIB3 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) antibodyTRIB3 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) (C-Term) antibodyTRIB3 Reaktivität: Human IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) (C-Term) antibodyTRIB3 Reaktivität: Human, Maus WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) (AA 201-300) antibodyTRIB3 Reaktivität: Human, Ratte ELISA, IHC (p), FACS, IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) (AA 301-331), (C-Term) antibodyTRIB3 Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal RB4072 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRIB3 Blocking Peptide, catalog no. 33R-10278, is also available for use as a blocking control in assays to test for specificity of this TRIB3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIB3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRIB3 (Tribbles Homolog 3 (Drosophila) (TRIB3))
- Andere Bezeichnung
- TRIB3 (TRIB3 Produkte)
- Synonyme
- zgc:76966 antikoerper, TRIB3 antikoerper, C20orf97 antikoerper, NIPK antikoerper, SINK antikoerper, SKIP3 antikoerper, TRB3 antikoerper, Ifld2 antikoerper, Nipk antikoerper, TRB-3 antikoerper, Trb3 antikoerper, tribbles pseudokinase 3 antikoerper, trib3 antikoerper, TRIB3 antikoerper, Trib3 antikoerper
- Hintergrund
- The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1.
- Molekulargewicht
- 39 kDa (MW of target protein)
- Pathways
- Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Regulation of Lipid Metabolism by PPARalpha
-
Sie sind hier:
