MAT2B Antikörper (N-Term)

Produktnummer ABIN632144

Produktdetails anti-MAT2B Antikörper

Target: MAT2B (Methionine Adenosyltransferase II, beta (MAT2B))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAT2B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAT2 B antibody was raised against the N terminal of MAT2

Aufreinigung: Affinity purified

Immunogen: MAT2 B antibody was raised using the N terminal of MAT2 corresponding to a region with amino acids KEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAT2B Blocking Peptide, catalog no. 33R-4332, is also available for use as a blocking control in assays to test for specificity of this MAT2B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAT2B

Target: MAT2B (Methionine Adenosyltransferase II, beta (MAT2B))

Andere Bezeichnung: MAT2B (MAT2B Produkte)

Synonyme: MAT-II antikoerper, MATIIbeta antikoerper, Nbla02999 antikoerper, SDR23E1 antikoerper, TGR antikoerper, 1110064C04Rik antikoerper, 2410018D16Rik antikoerper, AI182287 antikoerper, AU022853 antikoerper, fc55d01 antikoerper, wu:fb48h02 antikoerper, wu:fc55d01 antikoerper, zgc:110308 antikoerper, MAT2beta antikoerper, methionine adenosyltransferase 2B antikoerper, methionine adenosyltransferase II, beta antikoerper, methionine adenosyltransferase II, beta L homeolog antikoerper, MAT2B antikoerper, Mat2b antikoerper, mat2b antikoerper, mat2b.L antikoerper

Hintergrund: MAT2B belongs to the methionine adenosyltransferase (MAT) family. MAT catalyzes the biosynthesis of S-adenosylmethionine from methionine and ATP. This protein is the regulatory beta subunit of MAT.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process, SARS-CoV-2 Protein Interaktom