RUVBL2 Antikörper

Produktnummer ABIN632139

Produktdetails anti-RUVBL2 Antikörper

Target: RUVBL2 (RuvB-Like 2 (E. Coli) (RUVBL2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RUVBL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: RUVBL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITID

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RUVBL2 Blocking Peptide, catalog no. 33R-3928, is also available for use as a blocking control in assays to test for specificity of this RUVBL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RUVBL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RUVBL2

Target: RUVBL2 (RuvB-Like 2 (E. Coli) (RUVBL2))

Andere Bezeichnung: RUVBL2 (RUVBL2 Produkte)

Synonyme: ECP51 antikoerper, INO80J antikoerper, REPTIN antikoerper, RVB2 antikoerper, TIH2 antikoerper, TIP48 antikoerper, TIP49B antikoerper, mp47 antikoerper, p47 antikoerper, reptin antikoerper, wu:fi25f01 antikoerper, zreptin antikoerper, MGC52995 antikoerper, tip48 antikoerper, xReptin antikoerper, rvb2 antikoerper, ecp51 antikoerper, cgi-46 antikoerper, tip49b antikoerper, MGC69398 antikoerper, RUVBL2 antikoerper, AAEL010341 antikoerper, Reptin antikoerper, rept antikoerper, RuvB like AAA ATPase 2 antikoerper, RuvB-like protein 2 antikoerper, RuvB-like AAA ATPase 2 antikoerper, RuvB like AAA ATPase 2 L homeolog antikoerper, ruvB-like 2 antikoerper, TATA box-binding protein antikoerper, ruvb-like 2 antikoerper, ruvB-like helicase 2 antikoerper, RUVBL2 antikoerper, Ruvbl2 antikoerper, ruvbl2 antikoerper, ruvbl2.L antikoerper, LOC726816 antikoerper, HBUT_RS02095 antikoerper, HAN_2g314 antikoerper, LOC100282179 antikoerper, LOC100284260 antikoerper, LOC5573243 antikoerper

Hintergrund: RUVBL2 encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities.

Molekulargewicht: 51 kDa (MW of target protein)

Pathways: Telomere Maintenance