RUVBL2 Antikörper

Produktnummer ABIN632139

Dieser Anti-RUVBL2 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von RUVBL2 in WB und IHC. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für RUVBL2 Antikörper (ABIN632139)

Target: RUVBL2 (RuvB-Like 2 (E. Coli) (RUVBL2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RUVBL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-RUVBL2 Antikörper

Aufreinigung: Affinity purified

Immunogen: RUVBL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITID

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RUVBL2 Blocking Peptide, (ABIN939314), is also available for use as a blocking control in assays to test for specificity of this RUVBL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RUVBL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RUVBL2

Target: RUVBL2 (RuvB-Like 2 (E. Coli) (RUVBL2))

Andere Bezeichnung: RUVBL2

Hintergrund: RUVBL2 encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities.

Molekulargewicht: 51 kDa (MW of target protein)

Pathways: Telomere Maintenance