CCT8 Antikörper

Produktnummer ABIN632135

Der Kaninchen Polyklonal Anti-CCT8-Antikörper wurde für WB validiert. Er ist geeignet, CCT8 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für CCT8 Antikörper (ABIN632135)

Target: CCT8 (Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCT8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CCT8 Antikörper

Aufreinigung: Affinity purified

Immunogen: CCT8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCT8 Blocking Peptide, (ABIN937462), is also available for use as a blocking control in assays to test for specificity of this CCT8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCT8

Target: CCT8 (Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8))

Andere Bezeichnung: CCT8

Hintergrund: As a molecular chaperone, CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.

Molekulargewicht: 59 kDa (MW of target protein)