VGLL3 Antikörper

Produktnummer ABIN632133

Der Kaninchen Polyklonal anti-VGLL3 Antikörper (ABIN632133) detektiert spezifisch VGLL3 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Maus.

Kurzübersicht für VGLL3 Antikörper (ABIN632133)

Target: VGLL3 (Vestigial Like 3 (VGLL3))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VGLL3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-VGLL3 Antikörper

Aufreinigung: Affinity purified

Immunogen: VGLL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VGLL3 Blocking Peptide, (ABIN937049), is also available for use as a blocking control in assays to test for specificity of this VGLL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VGLL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VGLL3

Target: VGLL3 (Vestigial Like 3 (VGLL3))

Andere Bezeichnung: VGLL3

Hintergrund: VGLL3 belongs to the vestigial family. It may act as a specific coactivator for the mammalian TEFs.

Molekulargewicht: 36 kDa (MW of target protein)