VGLL3 Antikörper

Produktnummer ABIN632133

Produktdetails anti-VGLL3 Antikörper

Target: VGLL3 (Vestigial Like 3 (VGLL3))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VGLL3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: VGLL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VGLL3 Blocking Peptide, catalog no. 33R-1663, is also available for use as a blocking control in assays to test for specificity of this VGLL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VGLL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VGLL3

Target: VGLL3 (Vestigial Like 3 (VGLL3))

Andere Bezeichnung: VGLL3 (VGLL3 Produkte)

Synonyme: RGD1560030 antikoerper, VGL-3 antikoerper, VGL3 antikoerper, 1700110N18Rik antikoerper, 4832416J22 antikoerper, C80713 antikoerper, Vgl-3 antikoerper, Vito-2 antikoerper, vestigial-like family member 3 antikoerper, vestigial like family member 3 antikoerper, Vgll3 antikoerper, VGLL3 antikoerper

Hintergrund: VGLL3 belongs to the vestigial family. It may act as a specific coactivator for the mammalian TEFs.

Molekulargewicht: 36 kDa (MW of target protein)