C7orf29 Antikörper (Middle Region)

Produktnummer ABIN632132

Produktdetails anti-C7orf29 Antikörper

Target: C7orf29 (C7ORF29) (Chromosome 7 Open Reading Frame 29 (C7ORF29))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C7orf29 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C7 ORF29 antibody was raised against the middle region of C7 rf29

Aufreinigung: Affinity purified

Immunogen: C7 ORF29 antibody was raised using the middle region of C7 rf29 corresponding to a region with amino acids VKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C7ORF29 Blocking Peptide, catalog no. 33R-9618, is also available for use as a blocking control in assays to test for specificity of this C7ORF29 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF29 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C7orf29

Target: C7orf29 (C7ORF29) (Chromosome 7 Open Reading Frame 29 (C7ORF29))

Andere Bezeichnung: C7ORF29 (C7ORF29 Produkte)

Synonyme: C7orf29 antikoerper, ZBED6 C-terminal like antikoerper, ZBED6CL antikoerper

Hintergrund: The function of Chromosome 7 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 26 kDa (MW of target protein)