MAGEA6 Antikörper (Middle Region)

Produktnummer ABIN632131

Produktdetails anti-MAGEA6 Antikörper

Target: MAGEA6 (Melanoma Antigen Family A, 6 (MAGEA6))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAGEA6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAGEA6 antibody was raised against the middle region of MAGEA6

Aufreinigung: Affinity purified

Immunogen: MAGEA6 antibody was raised using the middle region of MAGEA6 corresponding to a region with amino acids APEEKIWEELSVLEVFEGREDSIFGDPKKLLTQYFVQENYLEYRQVPGSD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAGEA6 Blocking Peptide, catalog no. 33R-1419, is also available for use as a blocking control in assays to test for specificity of this MAGEA6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAGEA6

Target: MAGEA6 (Melanoma Antigen Family A, 6 (MAGEA6))

Andere Bezeichnung: MAGEA6 (MAGEA6 Produkte)

Synonyme: Mage-a6 antikoerper, CT1.6 antikoerper, MAGE-3b antikoerper, MAGE3B antikoerper, MAGE6 antikoerper, melanoma antigen, family A, 6 antikoerper, MAGE family member A6 antikoerper, Magea6 antikoerper, MAGEA6 antikoerper

Hintergrund: MAGEA6 gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls.

Molekulargewicht: 35 kDa (MW of target protein)