Adenylate Kinase 5 Antikörper (N-Term)
-
- Target Alle Adenylate Kinase 5 (AK5) Antikörper anzeigen
- Adenylate Kinase 5 (AK5)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Adenylate Kinase 5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AK5 antibody was raised against the N terminal of AK5
- Aufreinigung
- Affinity purified
- Immunogen
- AK5 antibody was raised using the N terminal of AK5 corresponding to a region with amino acids ESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY
- Top Product
- Discover our top product AK5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AK5 Blocking Peptide, catalog no. 33R-2721, is also available for use as a blocking control in assays to test for specificity of this AK5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Adenylate Kinase 5 (AK5)
- Andere Bezeichnung
- AK5 (AK5 Produkte)
- Hintergrund
- This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
- Molekulargewicht
- 62 kDa (MW of target protein)
- Pathways
- Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process
-