Adenylate Kinase 5 Antikörper (N-Term)

Produktnummer ABIN632129

Der Kaninchen Polyklonal Anti-Adenylate Kinase 5-Antikörper wurde für WB validiert. Er ist geeignet, Adenylate Kinase 5 in Proben von Human zu detektieren.

Kurzübersicht für Adenylate Kinase 5 Antikörper (N-Term) (ABIN632129)

Target: Adenylate Kinase 5 (AK5)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Adenylate Kinase 5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Adenylate Kinase 5 Antikörper

Bindungsspezifität: N-Term

Spezifität: AK5 antibody was raised against the N terminal of AK5

Aufreinigung: Affinity purified

Immunogen: AK5 antibody was raised using the N terminal of AK5 corresponding to a region with amino acids ESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AK5 Blocking Peptide, (ABIN938107), is also available for use as a blocking control in assays to test for specificity of this AK5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Adenylate Kinase 5

Target: Adenylate Kinase 5 (AK5)

Andere Bezeichnung: AK5

Hintergrund: This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.

Molekulargewicht: 62 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process