ANKMY2 Antikörper (N-Term)

Produktnummer ABIN632127

Dieser Anti-ANKMY2-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von ANKMY2 in WB. Geeignet für Human.

Kurzübersicht für ANKMY2 Antikörper (N-Term) (ABIN632127)

Target: ANKMY2 (Ankyrin Repeat and MYND Domain Containing 2 (ANKMY2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANKMY2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ANKMY2 Antikörper

Bindungsspezifität: N-Term

Spezifität: ANKMY2 antibody was raised against the N terminal of ANKMY2

Aufreinigung: Affinity purified

Immunogen: ANKMY2 antibody was raised using the N terminal of ANKMY2 corresponding to a region with amino acids DVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRERLDYYTKPQGLDKEPKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANKMY2 Blocking Peptide, (ABIN937612), is also available for use as a blocking control in assays to test for specificity of this ANKMY2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKMY2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANKMY2

Target: ANKMY2 (Ankyrin Repeat and MYND Domain Containing 2 (ANKMY2))

Andere Bezeichnung: ANKMY2

Hintergrund: The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 49 kDa (MW of target protein)