EML1 Antikörper (C-Term)

Produktnummer ABIN632123

Produktdetails anti-EML1 Antikörper

Target: EML1 (Echinoderm Microtubule Associated Protein Like 1 (EML1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EML1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EML1 antibody was raised against the C terminal of EML1

Aufreinigung: Affinity purified

Immunogen: EML1 antibody was raised using the C terminal of EML1 corresponding to a region with amino acids YPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EML1 Blocking Peptide, catalog no. 33R-10195, is also available for use as a blocking control in assays to test for specificity of this EML1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EML1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EML1

Target: EML1 (Echinoderm Microtubule Associated Protein Like 1 (EML1))

Andere Bezeichnung: EML1 (EML1 Produkte)

Synonyme: ELP79 antikoerper, EMAP antikoerper, EMAPL antikoerper, HuEMAP antikoerper, EML1 antikoerper, MGC108311 antikoerper, wu:fj01a06 antikoerper, zgc:153105 antikoerper, 1110008N23Rik antikoerper, A930030P13Rik antikoerper, AA171013 antikoerper, AI847476 antikoerper, AI853955 antikoerper, echinoderm microtubule associated protein like 1 antikoerper, echinoderm microtubule associated protein like 1 S homeolog antikoerper, EML1 antikoerper, eml1.S antikoerper, eml1 antikoerper, Eml1 antikoerper

Hintergrund: Human echinoderm microtubule-associated protein-like is a strong candidate for the Usher syndrome type 1A gene. Usher syndromes (USHs) are a group of genetic disorders consisting of congenital deafness, retinitis pigmentosa, and vestibular dysfunction of variable onset and severity depending on the genetic type.

Molekulargewicht: 92 kDa (MW of target protein)