UFSP2 Antikörper (Middle Region)
-
- Target Alle UFSP2 (C4orf20) Antikörper anzeigen
- UFSP2 (C4orf20) (Chromosome 4 Open Reading Frame 20 (C4orf20))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UFSP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C4 ORF20 antibody was raised against the middle region of C4 rf20
- Aufreinigung
- Affinity purified
- Immunogen
- C4 ORF20 antibody was raised using the middle region of C4 rf20 corresponding to a region with amino acids TPVMIGGGVLAHTILGVAWNEITGQIKFLILDPHYTGAEDLQVILEKGWC
- Top Product
- Discover our top product C4orf20 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C4ORF20 Blocking Peptide, catalog no. 33R-9238, is also available for use as a blocking control in assays to test for specificity of this C4ORF20 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF20 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UFSP2 (C4orf20) (Chromosome 4 Open Reading Frame 20 (C4orf20))
- Andere Bezeichnung
- C4ORF20 (C4orf20 Produkte)
- Synonyme
- C4orf20 antikoerper, 1810047C23Rik antikoerper, RGD1311161 antikoerper, cb891 antikoerper, fb05c06 antikoerper, fk89d04 antikoerper, wu:fb05c06 antikoerper, wu:fk89d04 antikoerper, zgc:64113 antikoerper, UFM1 specific peptidase 2 antikoerper, UFM1-specific peptidase 2 antikoerper, UFM1-specific peptidase 2 L homeolog antikoerper, ufm1-specific peptidase 2 antikoerper, UFSP2 antikoerper, Ufsp2 antikoerper, ufsp2.L antikoerper, ufsp2 antikoerper
- Hintergrund
- C4ORF20 is a thiol protease which recognises and hydrolyzes the peptide bond at the C-terminal Gly of UFM1, an ubiquitin-like modifier protein bound to a number of target proteins. Does not hydrolyze SUMO1 or ISG15 ubiquitin-like proteins.
- Molekulargewicht
- 53 kDa (MW of target protein)
-