UFSP2 Antikörper (Middle Region)

Produktnummer ABIN632121

Produktdetails anti-UFSP2 Antikörper

Target: UFSP2 (C4orf20) (Chromosome 4 Open Reading Frame 20 (C4orf20))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UFSP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C4 ORF20 antibody was raised against the middle region of C4 rf20

Aufreinigung: Affinity purified

Immunogen: C4 ORF20 antibody was raised using the middle region of C4 rf20 corresponding to a region with amino acids TPVMIGGGVLAHTILGVAWNEITGQIKFLILDPHYTGAEDLQVILEKGWC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C4ORF20 Blocking Peptide, catalog no. 33R-9238, is also available for use as a blocking control in assays to test for specificity of this C4ORF20 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UFSP2

Target: UFSP2 (C4orf20) (Chromosome 4 Open Reading Frame 20 (C4orf20))

Andere Bezeichnung: C4ORF20 (C4orf20 Produkte)

Synonyme: C4orf20 antikoerper, 1810047C23Rik antikoerper, RGD1311161 antikoerper, cb891 antikoerper, fb05c06 antikoerper, fk89d04 antikoerper, wu:fb05c06 antikoerper, wu:fk89d04 antikoerper, zgc:64113 antikoerper, UFM1 specific peptidase 2 antikoerper, UFM1-specific peptidase 2 antikoerper, UFM1-specific peptidase 2 L homeolog antikoerper, ufm1-specific peptidase 2 antikoerper, UFSP2 antikoerper, Ufsp2 antikoerper, ufsp2.L antikoerper, ufsp2 antikoerper

Hintergrund: C4ORF20 is a thiol protease which recognises and hydrolyzes the peptide bond at the C-terminal Gly of UFM1, an ubiquitin-like modifier protein bound to a number of target proteins. Does not hydrolyze SUMO1 or ISG15 ubiquitin-like proteins.

Molekulargewicht: 53 kDa (MW of target protein)