SSBP3 Antikörper (Middle Region)

Produktnummer ABIN632119

Produktdetails anti-SSBP3 Antikörper

Target: SSBP3 (Single Stranded DNA Binding Protein 3 (SSBP3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SSBP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SSBP3 antibody was raised against the middle region of SSBP3

Aufreinigung: Affinity purified

Immunogen: SSBP3 antibody was raised using the middle region of SSBP3 corresponding to a region with amino acids DIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SSBP3 Blocking Peptide, catalog no. 33R-1990, is also available for use as a blocking control in assays to test for specificity of this SSBP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSBP3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SSBP3

Target: SSBP3 (Single Stranded DNA Binding Protein 3 (SSBP3))

Andere Bezeichnung: SSBP3 (SSBP3 Produkte)

Synonyme: ssbp3 antikoerper, MGC75859 antikoerper, SSBP3 antikoerper, SSDP1b antikoerper, si:dkey-63k7.6 antikoerper, csdp antikoerper, ssdp antikoerper, ssdp1 antikoerper, CSDP antikoerper, SSDP antikoerper, SSDP1 antikoerper, Ssdp antikoerper, Ssdp3 antikoerper, SSDP1a antikoerper, id:ibd1109 antikoerper, zgc:63791 antikoerper, 2610021L12Rik antikoerper, 2610200M23Rik antikoerper, 5730488C10Rik antikoerper, AI854733 antikoerper, AW551939 antikoerper, LAST antikoerper, single stranded DNA binding protein 3 antikoerper, single stranded DNA binding protein 3a antikoerper, single stranded DNA binding protein 3 L homeolog antikoerper, single stranded DNA binding protein 3b antikoerper, single-stranded DNA binding protein 3 antikoerper, ssbp3 antikoerper, SSBP3 antikoerper, ssbp3a antikoerper, ssbp3.L antikoerper, Ssbp3 antikoerper, ssbp3b antikoerper

Hintergrund: SSBP3 may be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.

Molekulargewicht: 38 kDa (MW of target protein)