SSBP3 Antikörper (Middle Region)

Produktnummer ABIN632119

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SSBP3 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für SSBP3 Antikörper (Middle Region) (ABIN632119)

Target: SSBP3 (Single Stranded DNA Binding Protein 3 (SSBP3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SSBP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SSBP3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SSBP3 antibody was raised against the middle region of SSBP3

Aufreinigung: Affinity purified

Immunogen: SSBP3 antibody was raised using the middle region of SSBP3 corresponding to a region with amino acids DIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SSBP3 Blocking Peptide, (ABIN937376), is also available for use as a blocking control in assays to test for specificity of this SSBP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSBP3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SSBP3

Target: SSBP3 (Single Stranded DNA Binding Protein 3 (SSBP3))

Andere Bezeichnung: SSBP3

Hintergrund: SSBP3 may be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.

Molekulargewicht: 38 kDa (MW of target protein)