CCDC69 Antikörper (Middle Region)

Produktnummer ABIN632117

Der Kaninchen Polyklonal Anti-CCDC69-Antikörper wurde für WB validiert. Er ist geeignet, CCDC69 in Proben von Human zu detektieren.

Kurzübersicht für CCDC69 Antikörper (Middle Region) (ABIN632117)

Target: CCDC69 (Coiled-Coil Domain Containing 69 (CCDC69))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC69 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CCDC69 Antikörper

Bindungsspezifität: Middle Region

Spezifität: CCDC69 antibody was raised against the middle region of CCDC69

Aufreinigung: Affinity purified

Immunogen: CCDC69 antibody was raised using the middle region of CCDC69 corresponding to a region with amino acids TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC69 Blocking Peptide, (ABIN5612714), is also available for use as a blocking control in assays to test for specificity of this CCDC69 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC69 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCDC69

Target: CCDC69 (Coiled-Coil Domain Containing 69 (CCDC69))

Andere Bezeichnung: CCDC69

Hintergrund: The function of CCDC69 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 35 kDa (MW of target protein)