LIX1L Antikörper

Produktnummer ABIN632112

Dieser Anti-LIX1L Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von LIX1L in WB. Geeignet für Human und Ratte.

Kurzübersicht für LIX1L Antikörper (ABIN632112)

Target: LIX1L (Lix1 Homolog Like (LIX1L))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIX1L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LIX1L Antikörper

Aufreinigung: Affinity purified

Immunogen: LIX1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LIX1L Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this LIX1L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIX0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LIX1L

Target: LIX1L (Lix1 Homolog Like (LIX1L))

Andere Bezeichnung: LIX1L

Hintergrund: LIX1L may function as a modulator of fat signaling.

Molekulargewicht: 36 kDa (MW of target protein)