ASXL2 Antikörper

Produktnummer ABIN632099

Der Kaninchen Polyklonal anti-ASXL2 Antikörper wird verwendet zum Nachweis von ASXL2 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für ASXL2 Antikörper (ABIN632099)

Target: ASXL2 (Additional Sex Combs Like 2 (ASXL2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASXL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ASXL2 Antikörper

Aufreinigung: Affinity purified

Immunogen: ASXL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEAPVSWEKRPRVTENRQHQQPFQVSPQPFLNRGDRIQVRKVPPLKIPVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASXL2 Blocking Peptide, (ABIN937723), is also available for use as a blocking control in assays to test for specificity of this ASXL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASXL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASXL2

Target: ASXL2 (Additional Sex Combs Like 2 (ASXL2))

Andere Bezeichnung: ASXL2

Hintergrund: ASXL2 is a human homolog of the Drosophila asx gene. Drosophila asx is an enhancer of trithorax and polycomb gene that encodes a chromatin protein with dual functions in transcriptional activation and silencing.

Molekulargewicht: 154 kDa (MW of target protein)

Pathways: Positive Regulation of fat Cell Differentiation