MDP1 Antikörper (N-Term)

Produktnummer ABIN632094

Dieses Anti-MDP1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von MDP1 in WB. Geeignet für Human.

Kurzübersicht für MDP1 Antikörper (N-Term) (ABIN632094)

Target: MDP1 (Magnesium-Dependent Phosphatase 1 (MDP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MDP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MDP1 Antikörper

Bindungsspezifität: N-Term

Spezifität: MDP1 antibody was raised against the N terminal Of Mdp-1

Aufreinigung: Affinity purified

Immunogen: MDP1 antibody was raised using the N terminal Of Mdp-1 corresponding to a region with amino acids MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MDP1 Blocking Peptide, (ABIN5614714), is also available for use as a blocking control in assays to test for specificity of this MDP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDP-1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MDP1

Target: MDP1 (Magnesium-Dependent Phosphatase 1 (MDP1))

Andere Bezeichnung: MDP1

Hintergrund: MDP-1 is a magnesium-dependent phosphatase which may act as a tyrosine phosphatase.

Molekulargewicht: 20 kDa (MW of target protein)