CNN1 Antikörper (N-Term)
-
- Target Alle CNN1 Antikörper anzeigen
- CNN1 (Calponin 1 (CNN1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CNN1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Calponin 1 antibody was raised against the N terminal of CNN1
- Aufreinigung
- Affinity purified
- Immunogen
- Calponin 1 antibody was raised using the N terminal of CNN1 corresponding to a region with amino acids MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNF
- Top Product
- Discover our top product CNN1 Primärantikörper
-
anti-Calponin 1 (CNN1) (AA 1-268) antibody
CNN1 Reaktivität: Human IHC, WB, ICC, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Calponin 1 (CNN1) (AA 201-297) antibodyCNN1 Reaktivität: Human, Ratte, Maus FACS, WB, IHC (p), ELISA, IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Calponin 1 (CNN1) antibodyCNN1 Reaktivität: Human IF, IHC, WB Wirt: Kaninchen Monoclonal unconjugated
anti-Calponin 1 (CNN1) (AA 10-39), (N-Term) antibodyCNN1 Reaktivität: Human FACS, WB, IHC (p) Wirt: Kaninchen Polyclonal RB19472 unconjugated
anti-Calponin 1 (CNN1) (AA 16-165) antibodyCNN1 Reaktivität: Human IHC, WB, ELISA Wirt: Maus Monoclonal 1H5B5 unconjugated
anti-Calponin 1 (CNN1) antibodyCNN1 Reaktivität: Human, Ratte FACS, IF, IHC, StM Wirt: Kaninchen Monoclonal CNN1-1408R unconjugated Recombinant Antibody
anti-Calponin 1 (CNN1) antibodyCNN1 Reaktivität: Human, Ratte FACS, IF, IHC, WB, StM Wirt: Maus Monoclonal CALP unconjugated
anti-Calponin 1 (CNN1) antibodyCNN1 Reaktivität: Human, Ratte FACS, IHC, WB, StM Wirt: Maus Monoclonal rCNN1-832 unconjugated Recombinant Antibody
anti-Calponin 1 (CNN1) (AA 1-297) antibodyCNN1 Reaktivität: Human WB, IHC (p), ELISA Wirt: Maus Monoclonal 2F5-1H4 unconjugated
anti-Calponin 1 (CNN1) (C-Term) antibodyCNN1 Reaktivität: Human IHC Wirt: Kaninchen Monoclonal MSVA-455R unconjugated Recombinant Antibody
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Calponin 1 Blocking Peptide, catalog no. 33R-6495, is also available for use as a blocking control in assays to test for specificity of this Calponin 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CNN1 (Calponin 1 (CNN1))
- Andere Bezeichnung
- Calponin 1 (CNN1 Produkte)
- Synonyme
- CN antikoerper, CnnI antikoerper, SMCC antikoerper, Sm-Calp antikoerper, XclpH3 antikoerper, clpH3 antikoerper, cnn2 antikoerper, calponin 1 antikoerper, calponin 1, basic, smooth muscle L homeolog antikoerper, cnn1 antikoerper, Cnn1 antikoerper, CNN1 antikoerper, cnn1.L antikoerper
- Hintergrund
- CNN1 is a thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.
- Molekulargewicht
- 33 kDa (MW of target protein)
-
