CNN1 Antikörper (N-Term)

Produktnummer ABIN632093

Der Kaninchen Polyklonal Anti-CNN1-Antikörper wurde für WB validiert. Er ist geeignet, CNN1 in Proben von Human, Ratte und Maus zu detektieren.

Kurzübersicht für CNN1 Antikörper (N-Term) (ABIN632093)

Target: CNN1 (Calponin 1 (CNN1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CNN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CNN1 Antikörper

Bindungsspezifität: N-Term

Spezifität: Calponin 1 antibody was raised against the N terminal of CNN1

Aufreinigung: Affinity purified

Immunogen: Calponin 1 antibody was raised using the N terminal of CNN1 corresponding to a region with amino acids MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Calponin 1 Blocking Peptide, catalog no. 33R-6495, is also available for use as a blocking control in assays to test for specificity of this Calponin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CNN1

Target: CNN1 (Calponin 1 (CNN1))

Andere Bezeichnung: Calponin 1

Hintergrund: CNN1 is a thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.

Molekulargewicht: 33 kDa (MW of target protein)