PLAC9 Antikörper (Middle Region)

Produktnummer ABIN632092

Produktdetails anti-PLAC9 Antikörper

Target: PLAC9 (Placenta-Specific 9 (PLAC9))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLAC9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PLAC9 antibody was raised against the middle region of PLAC9

Aufreinigung: Affinity purified

Immunogen: PLAC9 antibody was raised using the middle region of PLAC9 corresponding to a region with amino acids RRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLAC9 Blocking Peptide, catalog no. 33R-8146, is also available for use as a blocking control in assays to test for specificity of this PLAC9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLAC9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PLAC9

Target: PLAC9 (Placenta-Specific 9 (PLAC9))

Andere Bezeichnung: PLAC9 (PLAC9 Produkte)

Synonyme: placenta-specific 9 antikoerper, placenta specific 9 antikoerper, Plac9 antikoerper, PLAC9 antikoerper

Hintergrund: The function of PLAC9 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 10 kDa (MW of target protein)