FABP1 Antikörper (N-Term)

Produktnummer ABIN632091

Produktdetails anti-FABP1 Antikörper

Target: FABP1 (Fatty Acid Binding Protein 1, Liver (FABP1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FABP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FABP1 antibody was raised against the N terminal of FABP1

Aufreinigung: Affinity purified

Immunogen: FABP1 antibody was raised using the N terminal of FABP1 corresponding to a region with amino acids MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FABP1 Blocking Peptide, catalog no. 33R-6421, is also available for use as a blocking control in assays to test for specificity of this FABP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FABP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FABP1

Target: FABP1 (Fatty Acid Binding Protein 1, Liver (FABP1))

Andere Bezeichnung: FABP1 (FABP1 Produkte)

Synonyme: FABPL antikoerper, L-FABP antikoerper, KAT4 antikoerper, KATIV antikoerper, mitAAT antikoerper, Fabpl antikoerper, Fabplg antikoerper, SCP antikoerper, SCP. antikoerper, p14 antikoerper, FABP1 antikoerper, FABP antikoerper, LFABP antikoerper, liver antikoerper, fabp1 antikoerper, Fabp1 antikoerper, FABP-1 antikoerper, FABPpm antikoerper, mAspAT antikoerper, fatty acid binding protein 1 antikoerper, glutamic-oxaloacetic transaminase 2 antikoerper, fatty acid binding protein 1, liver antikoerper, fatty acid binding protein 1a, liver antikoerper, fatty acid-binding protein, liver antikoerper, FABP1 antikoerper, GOT2 antikoerper, Fabp1 antikoerper, fabp1a antikoerper, LOC100726384 antikoerper

Hintergrund: FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands.

Molekulargewicht: 14 kDa (MW of target protein)

Pathways: Chromatin Binding, Regulation of Lipid Metabolism by PPARalpha