ACTR3B Antikörper

Produktnummer ABIN632090

Der Kaninchen Polyklonal Anti-ACTR3B-Antikörper wurde für WB validiert. Er ist geeignet, ACTR3B in Proben von Human zu detektieren.

Kurzübersicht für ACTR3B Antikörper (ABIN632090)

Target: ACTR3B (ARP3 Actin-Related Protein 3 Homolog B (ACTR3B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACTR3B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACTR3B Antikörper

Aufreinigung: Affinity purified

Immunogen: ACTR3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACTR3B Blocking Peptide, (ABIN937372), is also available for use as a blocking control in assays to test for specificity of this ACTR3B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACTR3B

Target: ACTR3B (ARP3 Actin-Related Protein 3 Homolog B (ACTR3B))

Andere Bezeichnung: ACTR3B

Hintergrund: ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization