C12orf4 Antikörper (N-Term)

Produktnummer ABIN632079

Produktdetails anti-C12orf4 Antikörper

Target: C12orf4 (Chromosome 12 Open Reading Frame 4 (C12orf4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C12orf4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C12 ORF4 antibody was raised against the N terminal Of C12 rf4

Aufreinigung: Affinity purified

Immunogen: C12 ORF4 antibody was raised using the N terminal Of C12 rf4 corresponding to a region with amino acids EESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C12ORF4 Blocking Peptide, catalog no. 33R-2390, is also available for use as a blocking control in assays to test for specificity of this C12ORF4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C12orf4

Target: C12orf4 (Chromosome 12 Open Reading Frame 4 (C12orf4))

Andere Bezeichnung: C12ORF4 (C12orf4 Produkte)

Synonyme: MGC53313 antikoerper, C12orf4 antikoerper, MGC79726 antikoerper, chromosome 12 open reading frame 4 L homeolog antikoerper, chromosome 1 open reading frame, human C12orf4 antikoerper, chromosome 12 open reading frame 4 antikoerper, chromosome 11 open reading frame, human C12orf4 antikoerper, chromosome 12 open reading frame, human C12orf4 antikoerper, DNA segment, Chr 6, Wayne State University 163, expressed antikoerper, c12orf4.L antikoerper, C1H12ORF4 antikoerper, c12orf4 antikoerper, C11H12orf4 antikoerper, C12H12orf4 antikoerper, C12orf4 antikoerper, D6Wsu163e antikoerper

Hintergrund: The function of Chromosome 12 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 64 kDa (MW of target protein)