LDHD Antikörper (Middle Region)

Produktnummer ABIN632075

Produktdetails anti-LDHD Antikörper

Target: LDHD (Lactate Dehydrogenase D (LDHD))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LDHD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LDHD antibody was raised against the middle region of LDHD

Aufreinigung: Affinity purified

Immunogen: LDHD antibody was raised using the middle region of LDHD corresponding to a region with amino acids LLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LDHD Blocking Peptide, catalog no. 33R-5196, is also available for use as a blocking control in assays to test for specificity of this LDHD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LDHD

Target: LDHD (Lactate Dehydrogenase D (LDHD))

Andere Bezeichnung: LDHD (LDHD Produkte)

Synonyme: DLD antikoerper, 4733401P21Rik antikoerper, D8Bwg1320e antikoerper, Ac2-202 antikoerper, lactate dehydrogenase D antikoerper, LDHD antikoerper, ldhd antikoerper, Ldhd antikoerper

Hintergrund: The protein encoded by this gene belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. The similar protein in yeast has both D-lactate and D-glycerate dehydrogenase activities. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process