PLS1 Antikörper

Produktnummer ABIN632072

Produktdetails anti-PLS1 Antikörper

Target: PLS1 (Plastin 1 (PLS1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Plastin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Plastin 1 Blocking Peptide, catalog no. 33R-4152, is also available for use as a blocking control in assays to test for specificity of this Plastin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PLS1

Target: PLS1 (Plastin 1 (PLS1))

Andere Bezeichnung: Plastin 1 (PLS1 Produkte)

Synonyme: i-plastin antikoerper, DKFZp459F2151 antikoerper, Plastin-1 antikoerper, wu:fi38g03 antikoerper, zgc:63494 antikoerper, AI427122 antikoerper, plastin 1 antikoerper, plastin 1 (I isoform) antikoerper, plastin 1 (I-isoform) antikoerper, PLS1 antikoerper, pls1 antikoerper, Pls1 antikoerper

Hintergrund: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified.

Molekulargewicht: 70 kDa (MW of target protein)