NECAB3 Antikörper (N-Term)
-
- Target Alle NECAB3 Antikörper anzeigen
- NECAB3 (N-Terminal EF-Hand Calcium Binding Protein 3 (NECAB3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NECAB3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NECAB3 antibody was raised against the N terminal of NECAB3
- Aufreinigung
- Affinity purified
- Immunogen
- NECAB3 antibody was raised using the N terminal of NECAB3 corresponding to a region with amino acids MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADK
- Top Product
- Discover our top product NECAB3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NECAB3 Blocking Peptide, catalog no. 33R-5616, is also available for use as a blocking control in assays to test for specificity of this NECAB3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NECAB3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NECAB3 (N-Terminal EF-Hand Calcium Binding Protein 3 (NECAB3))
- Andere Bezeichnung
- NECAB3 (NECAB3 Produkte)
- Hintergrund
- The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.
- Molekulargewicht
- 44 kDa (MW of target protein)
-